Clostridium cellulosi: CCDG5_0637 Help Entry CCDG5_0637        CDS       T03806                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ccel  Clostridium cellulosi Pathway ccel00020   Citrate cycle (TCA cycle) ccel00720   Other carbon fixation pathways ccel01100   Metabolic pathways ccel01110   Biosynthesis of secondary metabolites ccel01120   Microbial metabolism in diverse environments ccel01200   Carbon metabolism ccel01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ccel00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CCDG5_0637   09102 Energy metabolism    00720 Other carbon fixation pathways     CCDG5_0637 Enzymes [BR:ccel01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CCDG5_0637 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_10 LdpA_Fe-S-bd Fer4_9 Fer4_21 Fer4_15 Fer4_4 Fer4_8 Fer4_22 Fer4_16 Fer4_3 Fer4_17 Fer4_13 Motif Other DBs NCBI-ProteinID:  CDZ23767 UniProt:  A0A078KMK5 LinkDB All DBs Position I:complement(684692..684895) Genome browser AA seq 67 aa AA seqDB search MPKVTVNEDLCKGCGLCVTACPKKIMVLSDKLNKKGYHPAHVFEIEKCIGCAMCAVMCPD VAIKVEK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccaaaagtcactgtcaatgaagacttgtgcaaaggctgtggactgtgtgtaacagcc tgtccgaaaaaaattatggttctaagcgataagcttaacaaaaagggatatcacccggcc catgtctttgaaatcgaaaaatgcataggctgtgctatgtgtgccgttatgtgtcccgat gtcgccattaaagtcgaaaagtaa

DBGET integrated database retrieval system