Clostridium cellulosi: CCDG5_0915 Help Entry CCDG5_0915        CDS       T03806                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ccel  Clostridium cellulosi Pathway ccel01100   Metabolic pathways ccel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCDG5_0915    00074 Mycolic acid biosynthesis     CCDG5_0915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCDG5_0915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CDZ24034 UniProt:  A0A078KSE3 LinkDB All DBs Position I:988256..988510 Genome browser AA seq 84 aa AA seqDB search MDNKVFEKVKEILRSQLPDGSSAEISLDDNLTDLGINSLLFVKIAVALETEFDIEFKDED LDIKRFKTVGDIVCYVEDKVSANI NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggacaataaggtatttgaaaaggttaaggaaatattgcgcagccagcttccagatggc tcaagtgcggagatatcgcttgatgataacttgacagatctgggtataaactcattgcta tttgtaaaaattgcggtcgcactggagacggagtttgacattgaatttaaggatgaagat ctggacatcaagagatttaaaaccgtcggagatatcgtttgctatgtggaagataaagta agtgccaatatttaa

DBGET integrated database retrieval system