Chlorobium chlorochromatii: Cag_1661 Help Entry Cag_1661          CDS       T00290                                  Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism cch  Chlorobium chlorochromatii Pathway cch01100   Metabolic pathways cch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cag_1661    00074 Mycolic acid biosynthesis     Cag_1661   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cag_1661 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 HLH Motif Other DBs NCBI-ProteinID:  ABB28913 UniProt:  Q3AQ12 LinkDB All DBs Position complement(2160303..2160542) Genome browser AA seq 79 aa AA seqDB search MTAAEIKDKVFDIIVSRMGVNKDQIKMESKFSDDLGADSLDTVELIMELENAFDVQIPDE DAEKIATVQQAVDYIVSKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaccgcagcggaaatcaaggataaggtatttgatatcattgtcagcagaatgggtgtc aacaaagatcagattaaaatggaatcgaaattttccgatgacctcggtgctgattcactc gataccgttgagctgatcatggaactcgagaatgcttttgatgttcagattcctgatgaa gatgctgagaaaattgctaccgtacagcaggctgttgattacattgtaagcaaacagtaa

DBGET integrated database retrieval system