Cohnella cholangitidis: FPL14_04835 Help Entry FPL14_04835       CDS       T07708                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cchl  Cohnella cholangitidis Pathway cchl00998   Biosynthesis of various antibiotics cchl01100   Metabolic pathways cchl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cchl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPL14_04835    00074 Mycolic acid biosynthesis     FPL14_04835   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPL14_04835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  QMV40603 UniProt:  A0A7G5BUG9 LinkDB All DBs Position complement(971399..971650) Genome browser AA seq 83 aa AA seqDB search MQMDSIELKISEIVREMLKVHGNVNLTADQNLFDIGLDSLNAIQLIVRLEEEFDIIIDDD ELIFDNFDSIEKIMEIMKNKQAV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaaatggattctattgaactgaaaataagcgaaatcgtacgcgaaatgctaaaggtt cacggtaacgttaacctgacggcggaccaaaacttgttcgatatcgggttggattcctta aatgccatccaactcatcgttagactggaagaagaattcgatattatcatcgatgacgac gaacttatattcgataatttcgacagcatcgagaagatcatggagattatgaagaacaaa caagcggtatag

DBGET integrated database retrieval system