Cohnella cholangitidis: FPL14_05970 Help Entry FPL14_05970       CDS       T07708                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cchl  Cohnella cholangitidis Pathway cchl00998   Biosynthesis of various antibiotics cchl01100   Metabolic pathways cchl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cchl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPL14_05970    00074 Mycolic acid biosynthesis     FPL14_05970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPL14_05970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding LOH1CR12 PP-binding_2 DUF5401 Motif Other DBs NCBI-ProteinID:  QMV40803 UniProt:  A0A7G5BV19 LinkDB All DBs Position complement(1215276..1215509) Genome browser AA seq 77 aa AA seqDB search MTDELRIQTASVLSEVLKVPVLPDDNPTREQLANWDSLNHMELILRLEEHFQVRFNGKEV AEIQSLDDLIHIIGVKL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacagacgaattgcgaatacaaaccgcctccgtcttatcggaggtgctgaaggtaccc gttctaccggatgataatccgactagggagcaactcgcgaactgggattccctcaaccat atggagctcattttgcgtctcgaagaacattttcaagtccggttcaatggcaaagaggta gcggaaatccaaagtttagatgatcttatccacatcataggagtgaaactatga

DBGET integrated database retrieval system