Cohnella cholangitidis: FPL14_06960 Help Entry FPL14_06960       CDS       T07708                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cchl  Cohnella cholangitidis Pathway cchl00998   Biosynthesis of various antibiotics cchl01100   Metabolic pathways cchl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cchl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPL14_06960    00074 Mycolic acid biosynthesis     FPL14_06960   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPL14_06960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  QMV40977 UniProt:  A0A7G5BVJ3 LinkDB All DBs Position complement(1423155..1423412) Genome browser AA seq 85 aa AA seqDB search MDKSIIEQKVCQWVREKATVPSEEIALDADLRDNYGIDSISLVELLVEIECAFDMTFDSA SLTNDYFSTAGSISEYVCRKLAVSA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggataaatcgatcattgaacaaaaagtatgccagtgggtaagggagaaagcgacggtt ccgagcgaagaaattgcgctggacgcggatttgcgggacaactacgggatcgactccatc tcgcttgtcgagctgctcgtggaaatcgaatgcgccttcgacatgaccttcgacagcgcg tccctgacgaacgactacttctccacggccggatcgatttcggaatacgtgtgccgcaag cttgcggtttcggcatga

DBGET integrated database retrieval system