Cohnella cholangitidis: FPL14_24380 Help Entry FPL14_24380       CDS       T07708                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cchl  Cohnella cholangitidis Pathway cchl00998   Biosynthesis of various antibiotics cchl01100   Metabolic pathways cchl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cchl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPL14_24380    00074 Mycolic acid biosynthesis     FPL14_24380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPL14_24380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QMV43962 UniProt:  A0A7G5C428 LinkDB All DBs Position 5326055..5326297 Genome browser AA seq 80 aa AA seqDB search MSDAQDKILDIISRVCKKERMTLSKDTDMGDLDFDSMTFVEIVLLMEEELGLTIPDNDLA LESFRTVADFEAAAVIWKQR NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgcacaggacaaaattttggatattatcagccgggtctgcaagaaggaacgg atgacgttgtctaaggataccgatatgggcgatttggatttcgattccatgactttcgtc gaaatcgtgcttctaatggaagaagagctcggattaacgattccggataacgatctcgcc ctggaaagcttcagaaccgtggccgacttcgaggcggcggcggtcatatggaaacaacgc tag

DBGET integrated database retrieval system