Corynebacterium choanae: CCHOA_01455 Help Entry CCHOA_01455       CDS       T06925                                  Name (GenBank) Putative glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ccho  Corynebacterium choanae Brite KEGG Orthology (KO) [BR:ccho00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CCHOA_01455 Enzymes [BR:ccho01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CCHOA_01455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_9 GST_N_3 Thioredoxin_2 BLH_phosphatase Thioredoxin Motif Other DBs NCBI-ProteinID:  AZA12719 UniProt:  A0A3G6J459 LinkDB All DBs Position complement(378014..378259) Genome browser AA seq 81 aa AA seqDB search MKLRVFGSDWCRDCRRTKAQLDELGIAYEYLDVATDPALADEAETIAGRKNIPVVVYPDG SHQVEPSNAEVEAALKANGLL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaacttcgtgtctttggttctgattggtgccgcgactgccgccgcacgaaagcacag ctcgatgagcttggtatcgcctacgagtatcttgacgttgctaccgatccggcgcttgcc gacgaggcggaaactatcgctgggcggaagaatattccggtcgtcgtctatcccgacggc agccaccaggttgaaccttccaacgctgaggtggaagcagctttgaaagctaacgggctg ctctag

DBGET integrated database retrieval system