Coprinopsis cinerea (gray shag): CC1G_00908 Help Entry CC1G_00908        CDS       T01275                                  Name (RefSeq) hypothetical protein   KO K03012   DNA-directed RNA polymerase II subunit RPB4 Organism cci  Coprinopsis cinerea (gray shag) Pathway cci03020   RNA polymerase cci03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cci00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CC1G_00908   09124 Replication and repair    03420 Nucleotide excision repair     CC1G_00908  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cci03021]     CC1G_00908    03400 DNA repair and recombination proteins [BR:cci03400]     CC1G_00908 Transcription machinery [BR:cci03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      CC1G_00908 DNA repair and recombination proteins [BR:cci03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CC1G_00908 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb4 Pneumovirus_M2 Motif Other DBs NCBI-GeneID:  6007833 NCBI-ProteinID:  XP_001831361 UniProt:  A8N933 LinkDB All DBs Position 7 AA seq 134 aa AA seqDB search MTTRLRQRATVDEEDAATLKLGPEFNNAGCLLISEVKYLLENREKDAPDTAVYNKTLDYV KTFAKFNTTDSASAVRETLRREPALTQFETAQIANLCPASAEEAKSIIPSLVKIDDDRLQ ALVDEIQTMRKFQT NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaccactcgactgcgacagagggccactgttgacgaagaggacgctgcaaccctcaaa cttggtccagagtttaacaatgccggttgcttgctgatttccgaagtcaagtatttgttg gagaacagagagaaggatgcaccggatactgctgtctataacaagactctggactatgtg aagacgttcgccaagttcaatactacggactcggcgagtgccgtacgagagactttgaga agggagcccgcccttacgcagtttgagactgcacagattgccaacttgtgccctgcttct gctgaggaagccaagagtatcattccaagtcttgtgaagatcgacgacgaccgcttacaa gctctcgtggatgaaatccagacaatgcgcaagttccagacgtag

DBGET integrated database retrieval system