Coprinopsis cinerea (gray shag): CC1G_01841 Help Entry CC1G_01841        CDS       T01275                                  Name (RefSeq) SEC61   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism cci  Coprinopsis cinerea (gray shag) Pathway cci03060   Protein export cci04141   Protein processing in endoplasmic reticulum cci04145   Phagosome Brite KEGG Orthology (KO) [BR:cci00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CC1G_01841    04141 Protein processing in endoplasmic reticulum     CC1G_01841  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CC1G_01841  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cci04131]     CC1G_01841   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cci02044]     CC1G_01841 Membrane trafficking [BR:cci04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CC1G_01841 Secretion system [BR:cci02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CC1G_01841 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Mit_proteolip Motif Other DBs NCBI-GeneID:  6005587 NCBI-ProteinID:  XP_001829161 UniProt:  A8N2T9 LinkDB All DBs Position 1 AA seq 70 aa AA seqDB search MSEKIREFVEVPQEFFQDGKQFLTRCTKPSKKEFTQICKAVAVGFAVMGFIGYFVKLIHI PINNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgagaagattcgtgaattcgtcgaggtcccccaggagttcttccaagatggaaag cagttcttgacacggtgcacaaaaccttcaaagaaggagttcacgcaaatctgcaaggca gtcgctgttggcttcgcagtcatgggcttcattggttactttgtcaagcttatccacatc ccaataaacaacatccttgtgggcggcgcctga

DBGET integrated database retrieval system