Coprinopsis cinerea (gray shag): CC1G_03820 Help Entry CC1G_03820        CDS       T01275                                  Name (RefSeq) IDI-7   KO K08341   GABA(A) receptor-associated protein Organism cci  Coprinopsis cinerea (gray shag) Pathway cci04136   Autophagy - other cci04138   Autophagy - yeast cci04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:cci00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     CC1G_03820    04136 Autophagy - other     CC1G_03820    04139 Mitophagy - yeast     CC1G_03820  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cci04131]     CC1G_03820    04121 Ubiquitin system [BR:cci04121]     CC1G_03820    03029 Mitochondrial biogenesis [BR:cci03029]     CC1G_03820 Membrane trafficking [BR:cci04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     CC1G_03820 Ubiquitin system [BR:cci04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    CC1G_03820 Mitochondrial biogenesis [BR:cci03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     CC1G_03820 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 DACZ_N TrmE_N Motif Other DBs NCBI-GeneID:  6010101 NCBI-ProteinID:  XP_001833603 UniProt:  A8NGU7 LinkDB All DBs Position 2 AA seq 127 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYPDRIPVICEKADRTDIPTIDKKKYLVPSDLTVGQF VYVIRKRIKLAPEKAIFIFVDEVLPPTAALMSAIYEEHKDEDNFLYVSYSGENTFGQEDW IELPLDA NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcgatccaagttcaaggacgagcaccccttcgagaagcgcaaggctgaagctgagcga attcgacagaagtacccggatcgtattcccgtcatctgtgagaaggcagacaggaccgat atccctactatcgacaagaagaagtacctggtgccatctgacctcacggttggacaattc gtgtatgtcatccgtaagcgaatcaagctggcaccagagaaggcgatcttcatcttcgtc gacgaggtcctcccaccgaccgcagcactcatgagcgcaatatacgaggagcataaggac gaggacaacttcctttatgtcagttactcaggagagaacacattcggtcaagaagactgg atcgagctgccgctagatgcatga

DBGET integrated database retrieval system