Coprinopsis cinerea (gray shag): CC1G_06738 Help Entry CC1G_06738        CDS       T01275                                  Name (RefSeq) hypothetical protein   KO K12620   U6 snRNA-associated Sm-like protein LSm1 Organism cci  Coprinopsis cinerea (gray shag) Pathway cci03018   RNA degradation Brite KEGG Orthology (KO) [BR:cci00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CC1G_06738  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cci03019]     CC1G_06738 Messenger RNA biogenesis [BR:cci03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      CC1G_06738   mRNA degradation factors    5'-3' decay     Lsm complex      CC1G_06738 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Hfq Motif Other DBs NCBI-GeneID:  6005178 NCBI-ProteinID:  XP_001828752 UniProt:  A8N1Q8 LinkDB All DBs Position 1 AA seq 116 aa AA seqDB search MLVVLRDGRKLHGVLRSYDQFANLVLEDTYERIYHRNMFAEQHHGLFLIRGENVVLMGEI DLDKEDDVPLKQVEYHQLEPYHIKELEHKKLHEEAKAQYLFEHNGFSREGGEGDGY NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctggttgtccttcgagacggcagaaagctacacggcgtattacgatcttatgaccag tttgccaacctcgtgttagaagacacctacgaaaggatatatcatcggaacatgtttgca gaacagcaccatggtctctttttgattcgaggggagaatgtcgtactgatgggcgaaatc gacctggataaagaagatgatgttcctctcaagcaggtagaataccaccagctcgaacca tatcatatcaaggaacttgaacacaagaaactgcacgaggaagcgaaagcgcaataccta ttcgaacataatggtttctcgcgagaaggtggtgagggtgatggatactag

DBGET integrated database retrieval system