Coprinopsis cinerea (gray shag): CC1G_06790 Help Entry CC1G_06790        CDS       T01275                                  Name (RefSeq) small GTPase Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cci  Coprinopsis cinerea (gray shag) Pathway cci04145   Phagosome cci04148   Efferocytosis cci04620   Toll-like receptor signaling pathway cci05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cci00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CC1G_06790    04148 Efferocytosis     CC1G_06790  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     CC1G_06790  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CC1G_06790  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cci04131]     CC1G_06790   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cci04147]     CC1G_06790    04031 GTP-binding proteins [BR:cci04031]     CC1G_06790 Membrane trafficking [BR:cci04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CC1G_06790  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     CC1G_06790   Macropinocytosis    Ras GTPases     CC1G_06790  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     CC1G_06790 Exosome [BR:cci04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CC1G_06790   Exosomal proteins of other body fluids (saliva and urine)    CC1G_06790   Exosomal proteins of colorectal cancer cells    CC1G_06790   Exosomal proteins of bladder cancer cells    CC1G_06790 GTP-binding proteins [BR:cci04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CC1G_06790 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  6005230 NCBI-ProteinID:  XP_001828804 UniProt:  A8N1R2 LinkDB All DBs Position 1 AA seq 194 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKTISLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVSPPSYENVRTKWYPEISHHAPSTSIVLVGTKLDLR EDPMTIEKLRERRMAPIQYSQGVAMAKDIGAVKYLECSALTQKGLKTVFDEAIRAVLNPP PRVSKKNSSRCVIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgcaagccattaaatgtgtcgttgtgggagacggtgctgtagggaagacctgtcttctc atttcttatacaacaaacgcgttccccggtgaatatattccaactgtattcgacaactac tctgcgaatgtgatggtagatggaaagaccatttctctgggattatgggatactgctggt caagaagattacgaccgactccgacccctgtcataccctcagaccgacgttttcctcatt tgcttctcgcttgttagtccccctagttatgagaacgtcaggacaaagtggtaccctgag atctctcatcacgcaccctcgacatccatcgttctggttggcaccaagcttgatttgcgg gaagaccccatgaccattgagaagttgcgagagcgccgcatggcacctatccaatactcc cagggcgttgcaatggcgaaagacattggcgcagtgaaatacctggaatgttccgcgctc acccagaagggtttgaagacagtcttcgacgaggctattcgcgcagtcttgaacccaccc cctcgtgtcagcaagaagaactcgagtcgctgcgtcatcctataa

DBGET integrated database retrieval system