Coprinopsis cinerea (gray shag): CC1G_09807 Help Entry CC1G_09807        CDS       T01275                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism cci  Coprinopsis cinerea (gray shag) Pathway cci03022   Basal transcription factors cci03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cci00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     CC1G_09807   09124 Replication and repair    03420 Nucleotide excision repair     CC1G_09807  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cci03021]     CC1G_09807    03400 DNA repair and recombination proteins [BR:cci03400]     CC1G_09807 Transcription machinery [BR:cci03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      CC1G_09807 DNA repair and recombination proteins [BR:cci03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      CC1G_09807 SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Binary_toxB_3 NAD_binding_7 Motif Other DBs NCBI-GeneID:  6011399 NCBI-ProteinID:  XP_001834880 UniProt:  A8NMB1 LinkDB All DBs Position 12 AA seq 65 aa AA seqDB search MRAIKGVLLTCDPAVKQILLAMNEKQNFIIEDLDDYHLVIKADDEMRVRRELEAELEKNT YSLDG NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcgagcaatcaaaggcgtcctgttgacctgcgacccagcagtgaaacaaatcttgctc gccatgaatgaaaaacagaacttcatcattgaagacctggacgactaccatctcgttatc aaggccgacgacgagatgagggtaaggagagaactcgaggctgagctcgagaagaacacc tattccctggacggatag

DBGET integrated database retrieval system