KEGG   Coprinopsis cinerea (gray shag): CC1G_13165
Entry
CC1G_13165        CDS       T01275                                 
Name
(RefSeq) metal resistance protein YCF1
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1 [EC:7.6.2.3]
Organism
cci  Coprinopsis cinerea (gray shag)
Pathway
cci02010  ABC transporters
cci04981  Folate transport and metabolism
Brite
KEGG Orthology (KO) [BR:cci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CC1G_13165
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    CC1G_13165
   04981 Folate transport and metabolism
    CC1G_13165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cci02000]
    CC1G_13165
Enzymes [BR:cci01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.3  ABC-type glutathione-S-conjugate transporter
     CC1G_13165
Transporters [BR:cci02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    CC1G_13165
SSDB
Motif
Pfam: ABC_membrane ABC_tran TMD0_ABC SMC_N AAA_29 AAA_23 UQCC3 MMR_HSR1 AAA_16 DO-GTPase2 RsgA_GTPase ATP-synt_ab 60KD_IMP
Other DBs
NCBI-GeneID: 6008003
NCBI-ProteinID: XP_001831530
UniProt: A8N9M4
LinkDB
Position
7
AA seq 1468 aa
MVPPTCHDPEGWWPISHKRAFDLTPCFEEGGLLSALLAVVVVTALLRTPHLATRQPLERS
RKSWSLLWVKLSPSSQSYIFESVALLAAIIITYFNHTRTRTSSSVLLLFWPLYFLGLVLW
FRTVVLTKLALFTPIVVLKGVTLALGLLSLVVETVGPEPDARADEKAQEESPVVTANIYS
IWTFGWMTPLMRKGASTYVTENDLPPLLERDKSVNLGHGLQRAMKKHVLWKALFVAYGGP
YAVAAGLKVIQDLLAFAQPQFLRWLLSYISDYQGARLLPDDDPLRPSKFEGFAIAVIMFV
ASVIQTIALNQYFQRTYETGMRVRAGLVTVIYEKALVLSNDERSRSSGDIVNLMSVDATR
LQDLCTYGLIALSGPLQITLAFISLYNLLGWSAFVGVAIMILSVPLNTFIARIMKRMQEQ
QMKNRDKRTRLMSELLANIKSIKLYAWENTFIRRVLETRNEHELKMLRKIGIVTSLNSLL
WSGIPILVAFSSFATAALTSSQPLTSDVIFPAMSLFMLLQFPLAMFAQVTSNIIEAMVSV
RRLADFLEARELQPDARKLVEDAAVREGDEVLSIKGGEFMWTSESIEPTLEDINLSVKKG
ELVGVFGRVGAGKTSLLAAIIGDMTKREGEVVIRGTVAYAPQNPWILSSTVRNNILFSHE
YDETFYNLVVEACALGPDLALLPHGDMTEVGEKGITLSGGQRARIALARAVYARADLTLL
DDCLAAVDSHVARHLFGKFCHNVIGPNGILADKARVFVTNSVAFVHQFDHIAFIRRGIIL
EQGTYTSLMQNPEAEIAKLVKGHGRGDSSGASGSSTPFPPSEPETAVMSEDSSNGKVSPP
ATSTILTEKVRRDASFPKARIAAISTLQDSASPGLTKEHQEKGSVKVEVYRAYIQAASKI
GFSLFLLVTVGQQAASVLATLTLRYWGEHNRETGSNVGMLKYLILYGSFSLGSSIFGGLS
SMIMWVYCALRSARMLHDSMLYSLMRAPLTFFELTPAGRILNLFSRDTYVVDQILARVIQ
SLCRTSAVTLSIIIVIGFSFPPFLLVVPPLAWFYLRVMKYYLATSRELKRLDAVSRSPIF
AWFSESLAGLSTIRAFNQQRVFSSINHNRVDRNQICYLPSISVNRWLAIRLEFVGAVIIF
VVALLAMWALITTGVDAGLVGLVLSYALNTTSSLNWLVRSASEVEQNIVSVERILHQTDV
EHEAPYEESAVTIPSGWPSKGGIRFDGYSARYRVGLDLVLRDVSLDIKPHEKIGICGRTG
AGKSSLLLALFRIIEPASGTIFIDDVDITKLGLYELRSAISIVPQTPDLFEGTLRENIDP
VGQYSDPDIWWALEQAHLKEHIMQIPGQLDAAVREGGSSLSSGQRQLLCFARALLRKTKI
LVLDEATSAVDLDTDKAIQEIIRGPAFKTVTILTIAHRLNTIIESDRVIVMDAGKVAEFE
SPKTLLQDVSSRFYGLVKEAGLIQAPEP
NT seq 4407 nt   +upstreamnt  +downstreamnt
atggtaccgcccacatgccacgacccagagggctggtggcccatctcacacaagagggcc
tttgatctcactccatgttttgaggagggcggcctcttgtctgctttgctcgccgtcgtc
gtcgtcaccgccctcttgaggacgccccatttggccacccgacagccattagaacgatct
agaaaaagctggtctctgctatgggtcaaactatccccgtcttcccagtcttatatcttc
gagtcggtggccctcctagcggcaatcatcatcacctacttcaaccatactagaacgaga
acttcttcctccgtcctgcttctcttctggcctctctacttccttgggcttgtcctctgg
ttcaggactgtggttctgacaaagcttgctttatttacgccaattgtcgtgctcaaggga
gttacacttgctctgggattgctttcgttggtggtggagacagtggggcctgagccggac
gcgagggccgatgagaaggcccaggaggagagcccggttgtcacagctaatatctatagc
atttggacgttcgggtggatgaccccgttgatgagaaagggtgcatctacctacgtaacc
gagaatgatctccctccgctgttggagagggacaagtcggttaaccttggtcatggtctt
caaagggccatgaagaagcatgtcctttggaaggccttgttcgttgcatatggaggaccg
tatgctgtcgcggctggattgaaagtcatccaggatttgctcgcctttgcacaacctcaa
tttctccgctggctgctgtcatatatttcggactaccagggtgcgaggctcttgccagac
gatgaccccctgcggcctagcaagtttgagggctttgcgattgcggtcattatgtttgtg
gcctcggtcatccagactattgccctcaaccagtacttccagaggacttatgagactggg
atgcgcgtgagggccgggctggtgacggttatctacgaaaaggcgctggttttgtccaat
gatgagaggtcgaggtcgagtggtgatattgtcaacctcatgtcggtcgatgccacccga
cttcaggacctgtgcacatatggtctgattgcactgtctggcccgcttcagatcacactt
gcgttcatttcactgtacaaccttcttgggtggtcagcgtttgttggtgtggcgatcatg
attctctcagtgcccctcaatacttttattgcgaggatcatgaagagaatgcaggaacag
caaatgaagaatcgcgataaaaggacgaggttgatgagcgagctattggcgaatatcaag
agtatcaagctgtatgcttgggagaatactttcattcgtagagtgcttgagacgaggaat
gagcacgagctgaagatgctcagaaagatcggaattgtgacgtcgctcaactcgttgctg
tggagcggtatcccgatcctggtcgcgtttagctcgtttgcgactgctgctctcacttca
agtcagcctttgacttctgatgtcatcttccctgccatgtcgcttttcatgctattgcag
ttccctctcgccatgttcgctcaagtaacctcgaacatcatcgaagcgatggtatcagtt
agacgattggcagatttcctggaagctagggaactgcaacccgatgcgcgaaagttggtt
gaagatgcggctgtacgggaaggggacgaggttctttccatcaagggtggcgagtttatg
tggaccagtgaatccattgagcctaccctggaggatatcaacctttcggtgaaaaagggc
gagttggttggtgtgtttggccgagtgggagctggaaagacaagtctgcttgctgcgatt
atcggtgacatgaccaagcgcgagggtgaggttgttattcggggaacggtagcgtatgcc
ccgcagaatccttggatcctttcctcgactgtgcggaataatatcctgttctcgcacgag
tatgacgaaaccttttacaacctcgtcgttgaagcttgcgctcttggaccggatctggct
ctgctgccccacggcgacatgactgaagtgggagaaaagggtatcacacttagcggtggt
caacgcgctcgaattgcgttggctcgtgcggtctatgcccgagctgatctcactctactt
gacgactgtctcgctgcggtggatagtcatgtcgcccgacatctttttggcaagttctgc
cacaatgttattgggcccaatggtatcctcgccgacaaggctcgcgttttcgtgaccaac
agcgtcgctttcgttcatcaattcgaccacatcgcgttcattcgtcgaggaatcattctg
gagcaggggacgtacacttcgctcatgcagaatccagaggccgagatcgcgaagctagtt
aagggtcatggtcgaggcgattcgtccggcgcatcgggcagctcgacgcctttccctccc
agtgaaccggaaacagcggtcatgtcggaagattcgagcaatggaaaggtttccccccct
gcaacctcgactattctcaccgagaaggtccggagagatgcgagcttccccaaagcacgt
atcgccgctatttcaacccttcaggatagtgcatcgcctggcctcaccaaggagcatcaa
gaaaagggtagtgtcaaggtcgaagtctacagggcctacatccaggctgcctcgaagatc
ggcttttctctcttcctcttggtcactgttggacaacaagcggcgtcagttttggctacg
cttacccttcggtactggggcgagcacaaccgtgaaaccggaagcaatgtgggtatgctc
aagtacctcattctctacggctccttctcgcttggatcgagtattttcggagggttgtcg
tcgatgatcatgtgggtatattgtgcactgaggagtgcacgtatgttgcacgattcgatg
ctgtactcgttgatgcgagcacccttgacgttcttcgagttgacgcctgctggacggatc
ttgaatctgttctcgagggatacttatgtcgtcgaccagatccttgcacgtgtcattcag
agcctgtgtcgtacatcggctgtcacactttcgattatcatcgtcattggcttcagtttc
cctcccttcttgctcgtcgttcctccgttggcctggttttacttgagggtgatgaagtat
tatctggccacatcgcgagaactcaagcgactcgatgcggtcagccggtcacctattttc
gcgtggttctcagaatcccttgcgggtctttcgactattcgagcattcaaccagcagcga
gtcttttcgtccatcaaccataaccgtgtcgacagaaatcaaatatgctaccttcctagc
atctcagttaaccgatggcttgccatccgactcgaatttgtcggtgctgtcattatcttt
gtcgtcgctctcttagccatgtgggctttgattaccacgggtgtggatgctgggctggtc
ggtttggtgctatcgtacgccctgaatacgacatcgtcgctgaattggcttgtccggtca
gcaagcgaggtcgagcaaaacatcgtcagcgtcgagcgtatcttgcaccagactgacgta
gagcatgaggcgccgtacgaggaatccgctgtcactattccttccggctggccttcaaaa
ggggggatccgattcgatggctactctgcacggtatcgcgttgggttggacctcgtctta
cgggatgtttccctagatattaaaccgcacgaaaagattggaatttgtggaaggactggg
gctggaaagtcatcgcttcttttggcgcttttccgcatcatcgagcctgcgtctggtacg
atctttatcgatgatgtagacatcaccaagctaggcctttatgaactgcgatcggctatc
tccatcgtcccccagacaccggacttgtttgagggaactcttcgagaaaatatcgatcca
gttgggcagtactctgaccctgatatttggtgggcgcttgaacaggcacatttgaaggag
catatcatgcagataccgggtcagttagatgctgctgtcagagaaggcgggtcctcgctt
tcgagcggccaaaggcagctgctttgtttcgctcgagctctcttgcgaaagacaaaaata
ctggttctcgatgaggcaacttcggctgttgatctggacaccgacaaggctatccaagag
attattcgcggcccggcctttaagactgtcactatcttgacaatcgcacatcgtctgaac
accatcattgagtctgaccgtgtgattgttatggatgcgggcaaggttgcggaatttgag
agtcccaagactctgttgcaagatgtgtcgtcgcggttctatgggctagtgaaggaagca
ggtctcattcaggctccagaaccatag

DBGET integrated database retrieval system