Coprinopsis cinerea (gray shag): CC1G_14050 Help Entry CC1G_14050        CDS       T01275                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism cci  Coprinopsis cinerea (gray shag) Pathway cci03083   Polycomb repressive complex cci04111   Cell cycle - yeast cci04120   Ubiquitin mediated proteolysis cci04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cci00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CC1G_14050    04120 Ubiquitin mediated proteolysis     CC1G_14050   09126 Chromosome    03083 Polycomb repressive complex     CC1G_14050  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     CC1G_14050  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cci04131]     CC1G_14050    04121 Ubiquitin system [BR:cci04121]     CC1G_14050    03036 Chromosome and associated proteins [BR:cci03036]     CC1G_14050 Membrane trafficking [BR:cci04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     CC1G_14050 Ubiquitin system [BR:cci04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      CC1G_14050    Cul7 complex      CC1G_14050 Chromosome and associated proteins [BR:cci03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      CC1G_14050   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      CC1G_14050 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 PKS_DE Hia_Tpr_ring_dom Motif Other DBs NCBI-GeneID:  9378545 NCBI-ProteinID:  XP_002912012 UniProt:  D6RL26 LinkDB All DBs Position 2 AA seq 172 aa AA seqDB search MSTDRIELESREGTTVTISRDAARKIQVLCDVLDLCTIQEGPIPLDIPGEALKKIVLWCE HEGTDPKPHTVQDPFTAWRFTDRWEQDFAMSMNWDLAMEVYHASHYLCLDGLIDLMAYTM ASHLEDLSPKDILARFGVSSDYSSKESEAFNNAVLPFLSRWREKKREPDDPS NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtcgactgacaggatcgagctcgaaagtcgggaaggcacgactgtgaccatttcccgc gacgctgcgcggaagatccaagtattgtgcgacgtattggatctgtgtactatacaagaa ggtcctatccctcttgacattcctggcgaggccttgaagaagattgtcctatggtgcgag cacgaaggaacagacccaaagccgcataccgttcaagatccattcactgcctggagattc acggatcgttgggaacaagatttcgctatgtctatgaattgggatttggcgatggaggtg taccatgcgtcccattacctatgcctggatggtctcatagatctaatggcctacacaatg gcaagtcatttagaggatctatctccaaaggacatcctggccaggtttggtgtatcatcc gactactcgagtaaggaatcggaagctttcaataacgccgttttgcccttcctctctcgt tggcgggagaagaagagagaacccgacgacccctcataa

DBGET integrated database retrieval system