Coprinopsis cinerea (gray shag): CC1G_15096 Help Entry CC1G_15096        CDS       T01275                                  Name (RefSeq) neuronal RhoA GEF protein   KO K04513   Ras homolog gene family, member A Organism cci  Coprinopsis cinerea (gray shag) Pathway cci04011   MAPK signaling pathway - yeast cci04081   Hormone signaling cci04144   Endocytosis cci05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cci00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     CC1G_15096   09133 Signaling molecules and interaction    04081 Hormone signaling     CC1G_15096  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     CC1G_15096  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CC1G_15096  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cci04131]     CC1G_15096   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cci04147]     CC1G_15096    04031 GTP-binding proteins [BR:cci04031]     CC1G_15096 Membrane trafficking [BR:cci04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     CC1G_15096 Exosome [BR:cci04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CC1G_15096   Exosomal proteins of other body fluids (saliva and urine)    CC1G_15096   Exosomal proteins of colorectal cancer cells    CC1G_15096   Exosomal proteins of bladder cancer cells    CC1G_15096 GTP-binding proteins [BR:cci04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     CC1G_15096 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU TIR_2 Arf Motif Other DBs NCBI-GeneID:  9378284 NCBI-ProteinID:  XP_002910762 UniProt:  D6RNZ2 LinkDB All DBs Position 8 AA seq 194 aa AA seqDB search MQVSGSSNATTTKLQAELEIWDTPGQDDWNQSWPQAFRNAHCVVICFSVGWEVSLECVEE KLIGRVLIIHTCHSQWIGTINHFGLTDIPILLVGCQRDLRSNQNEREAMKNSGERFVRPE QATGVAQRINAMSYLECSAKTWEGVREVLDEIALTVWVGASREKARAAKEEDRDGVVRSR VRRWSEGAKKLFKG NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgcaagtctctggaagctccaacgccaccacgaccaagctccaagccgaattggagata tgggacacacctggccaagacgactggaatcagtcctggcctcaagccttcagaaacgcc cactgcgttgtgatctgcttttcagtcgggtgggaggtttcgttggaatgtgtcgaggag aagcttatcgggagggtcctcataatacacacctgtcactcgcagtggatcggaaccatc aatcactttggccttaccgacattcctatacttttggtgggatgccagagagatctacgt tcaaaccagaacgagcgtgaagcgatgaagaattcaggggagaggtttgtaaggcccgaa caggcgactggagtggcccaacgaataaacgcaatgtcgtatctcgaatgctcagccaaa acgtgggaaggagttcgggaagtgctcgatgagattgcgttgactgtttgggttggggcg tcgcgggagaaggcgagagctgctaaggaggaagacagagatggtgttgttcgtagtcga gtgagaagatggagcgaaggagcgaagaagttattcaaaggctga

DBGET integrated database retrieval system