Cephus cinctus (wheat stem sawfly): 107264829 Help Entry 107264829         CDS       T07523                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ccin  Cephus cinctus (wheat stem sawfly) Pathway ccin04013   MAPK signaling pathway - fly ccin04145   Phagosome ccin04148   Efferocytosis ccin04310   Wnt signaling pathway ccin04517   IgSF CAM signaling ccin04518   Integrin signaling ccin04620   Toll-like receptor signaling pathway ccin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccin00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     107264829    04310 Wnt signaling pathway     107264829   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107264829    04518 Integrin signaling     107264829  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107264829    04148 Efferocytosis     107264829  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107264829  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107264829  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccin04131]     107264829   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccin04147]     107264829    04031 GTP-binding proteins [BR:ccin04031]     107264829 Membrane trafficking [BR:ccin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107264829  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107264829   Macropinocytosis    Ras GTPases     107264829  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107264829 Exosome [BR:ccin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107264829   Exosomal proteins of other body fluids (saliva and urine)    107264829   Exosomal proteins of colorectal cancer cells    107264829   Exosomal proteins of bladder cancer cells    107264829 GTP-binding proteins [BR:ccin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107264829 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107264829 NCBI-ProteinID:  XP_015589002 UniProt:  A0AAJ7BM18 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPRRKCCLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaagtgcgttgtggttggcgacggggcggtcggtaagacatgtttgctg ataagctacacgacaaatgcgttccccggggagtatattcccactgtattcgacaactac tcagcaaatgttatggtggatggaaaacctataaatcttggtctatgggatactgctgga caggaggattatgacaggctgagaccactgtcctatccgcagactgatgtctttcttatt tgcttctctttggtcaatcctgccagttttgagaatgtacgtgctaaatggtatccagag gttcgtcatcactgccctgccactcctattatcctggttggcactaaactggatttacgt gaggataaggagactattgaacgacttaaggataagaaacttgcacccatcacctatccg cagggtttggcgatggcaaaagaaattggagctgttaagtacctggaatgctcagctctg acgcagaagggactgaaaactgtgttcgacgaagcgatacgtgccgtcctctgtcccgtc cttcaagtgaagccaaggcgcaagtgttgcctcctataa

DBGET integrated database retrieval system