Cephus cinctus (wheat stem sawfly): 107264829 Help Entry 107264829         CDS       T07523                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ccin  Cephus cinctus (wheat stem sawfly) Pathway ccin04013   MAPK signaling pathway - fly ccin04145   Phagosome ccin04148   Efferocytosis ccin04310   Wnt signaling pathway ccin04620   Toll-like receptor signaling pathway ccin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccin00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     107264829    04310 Wnt signaling pathway     107264829  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107264829    04148 Efferocytosis     107264829  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107264829  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107264829  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccin04131]     107264829   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccin04147]     107264829    04031 GTP-binding proteins [BR:ccin04031]     107264829 Membrane trafficking [BR:ccin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107264829  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107264829   Macropinocytosis    Ras GTPases     107264829  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107264829 Exosome [BR:ccin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107264829   Exosomal proteins of other body fluids (saliva and urine)    107264829   Exosomal proteins of colorectal cancer cells    107264829   Exosomal proteins of bladder cancer cells    107264829 GTP-binding proteins [BR:ccin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107264829 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107264829 NCBI-ProteinID:  XP_015589002 UniProt:  A0AAJ7BM18 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPRRKCCLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaagtgcgttgtggttggcgacggggcggtcggtaagacatgtttgctg ataagctacacgacaaatgcgttccccggggagtatattcccactgtattcgacaactac tcagcaaatgttatggtggatggaaaacctataaatcttggtctatgggatactgctgga caggaggattatgacaggctgagaccactgtcctatccgcagactgatgtctttcttatt tgcttctctttggtcaatcctgccagttttgagaatgtacgtgctaaatggtatccagag gttcgtcatcactgccctgccactcctattatcctggttggcactaaactggatttacgt gaggataaggagactattgaacgacttaaggataagaaacttgcacccatcacctatccg cagggtttggcgatggcaaaagaaattggagctgttaagtacctggaatgctcagctctg acgcagaagggactgaaaactgtgttcgacgaagcgatacgtgccgtcctctgtcccgtc cttcaagtgaagccaaggcgcaagtgttgcctcctataa

DBGET integrated database retrieval system