Cephus cinctus (wheat stem sawfly): 107265140 Help Entry 107265140         CDS       T07523                                  Name (RefSeq) eclosion hormone   KO K28249   eclosion hormone Organism ccin  Cephus cinctus (wheat stem sawfly) Brite KEGG Orthology (KO) [BR:ccin00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccin04052]     107265140 Cytokines and neuropeptides [BR:ccin04052]  Neuropeptides   Unclassified    107265140 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Eclosion Motif Other DBs NCBI-GeneID:  107265140 NCBI-ProteinID:  XP_015589729 UniProt:  A0AAJ7BMD7 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MNTQTRYALLLLVAIAVLILSTSAGANQIGVCIRNCAQCKKMFGSYFEGQLCADTCVKFK GKIIPDCEDASSIAPFITKLADD NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaacacccaaacacgttatgctcttctgctcctcgtcgccattgctgttctgatcttg tccacatctgcaggcgccaatcaaattggtgtttgtataagaaattgtgctcagtgcaag aaaatgttcggatcctattttgagggacaactttgtgccgacacctgtgtcaagtttaag ggtaaaatcattcctgattgcgaggatgccagttccattgctccctttatcactaaattg gcagacgattaa

DBGET integrated database retrieval system