Cephus cinctus (wheat stem sawfly): 107265774 Help Entry 107265774         CDS       T07523                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism ccin  Cephus cinctus (wheat stem sawfly) Pathway ccin04070   Phosphatidylinositol signaling system ccin04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:ccin00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     107265774  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     107265774  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccin01009]     107265774   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccin04131]     107265774    03036 Chromosome and associated proteins [BR:ccin03036]     107265774   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccin04147]     107265774 Protein phosphatases and associated proteins [BR:ccin01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107265774 Membrane trafficking [BR:ccin04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107265774 Chromosome and associated proteins [BR:ccin03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107265774 Exosome [BR:ccin04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107265774 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin TerB FCaBP_EF-hand DUF5580_M SPEF2_C MotA_activ Fe_hyd_lg_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  107265774 NCBI-ProteinID:  XP_015591043 UniProt:  A0AAJ7FGR9 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccaactcacagaagagcaaatcgcggagttcaaggaagctttctcgctattc gacaaagatggcgatggcactatcactaccaaagaattgggcacagtcatgcgttctctt ggtcagaatccaacggaagctgaacttcaggatatgatcaacgaagtggatgctgacggt aacggaacaatcgactttcctgaatttctcacgatgatggcgcgtaaaatgaaggatacc gacagcgaggaggaaatcagggaggccttcagggtgttcgacaaggacggcaacggcttc atatccgcagcagagctcagacacgttatgacaaaccttggcgagaagctcaccgacgag gaggtcgatgagatgattcgggaggctgacatcgatggcgatggtcaagttaattacgaa gaattcgtcacaatgatgacatcaaagtga

DBGET integrated database retrieval system