Cephus cinctus (wheat stem sawfly): 107270386 Help Entry 107270386         CDS       T07523                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism ccin  Cephus cinctus (wheat stem sawfly) Pathway ccin04137   Mitophagy - animal ccin04140   Autophagy - animal ccin04144   Endocytosis ccin04145   Phagosome ccin04148   Efferocytosis Brite KEGG Orthology (KO) [BR:ccin00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107270386    04145 Phagosome     107270386    04140 Autophagy - animal     107270386    04137 Mitophagy - animal     107270386    04148 Efferocytosis     107270386  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccin04131]     107270386   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccin04147]     107270386    04031 GTP-binding proteins [BR:ccin04031]     107270386 Membrane trafficking [BR:ccin04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107270386 Exosome [BR:ccin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107270386   Exosomal proteins of other body fluids (saliva and urine)    107270386   Exosomal proteins of colorectal cancer cells    107270386   Exosomal proteins of bladder cancer cells    107270386 GTP-binding proteins [BR:ccin04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107270386 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase cobW ATP_bind_1 nSTAND3 Septin AAA_16 PduV-EutP AAA_7 AAA_22 AAA_24 AAA_5 NTPase_1 G-alpha FLYWCH_N ATPase_2 AAA_14 SRPRB NACHT NB-ARC ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  107270386 NCBI-ProteinID:  XP_015600832 UniProt:  A0AAJ7C3A2 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVAAPNTFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLENRAVSSKRAQQWCQLKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRSNGKGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcttcccgcaaaaaagtactgctcaaggtcattattttgggagactcgggagttggc aaaacctctctgatgaatcagtatgttaataaaaaattcagtaatcaatacaaagccact atcggtgctgacttccttacgaaggaagtgatggttgatgacaggatagtcaccatgcag atttgggatacagcaggccaggaaaggtttcaatctctgggagttgctttttacagaggc gcagattgttgcgtcctagtattcgatgttgcggcgcctaataccttcaagtctttagat tcctggagagatgaatttcttatccaagcgtcgccgcgggatcctgacaacttcccgttc gtcgtgctcggcaataaagttgaccttgaaaacagagcagtatccagcaagcgggcacaa cagtggtgccaattgaagaacaacataccgtatttcgaaactagcgcaaaagaggctatt aatgtcgagcaggcttttcaaacgatagcgaagaacgctttagcgcaagagagtgaggtg gagctatacaacgaatttcccgatcagatcaaattgactaacgaccaaaggagtaacggc aaaggagattcttgtgcctgttaa

DBGET integrated database retrieval system