Cephus cinctus (wheat stem sawfly): 107271774 Help Entry 107271774         CDS       T07523                                  Name (RefSeq) ras-like protein 1 isoform X1   KO K07827   GTPase KRas Organism ccin  Cephus cinctus (wheat stem sawfly) Pathway ccin04013   MAPK signaling pathway - fly ccin04068   FoxO signaling pathway ccin04137   Mitophagy - animal ccin04140   Autophagy - animal ccin04150   mTOR signaling pathway ccin04213   Longevity regulating pathway - multiple species ccin04214   Apoptosis - fly ccin04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:ccin00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     107271774    04068 FoxO signaling pathway     107271774    04150 mTOR signaling pathway     107271774  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107271774    04137 Mitophagy - animal     107271774   09143 Cell growth and death    04214 Apoptosis - fly     107271774  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     107271774   09149 Aging    04213 Longevity regulating pathway - multiple species     107271774  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccin04131]     107271774   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ccin04031]     107271774 Membrane trafficking [BR:ccin04131]  Endocytosis   Macropinocytosis    Ras GTPases     107271774 GTP-binding proteins [BR:ccin04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107271774 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase SLFN-g3_helicase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  107271774 NCBI-ProteinID:  XP_015603657 UniProt:  A0AAJ7FQR4 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QQSWAVNMTQAREVARQYGVPFVETSAKTRMGVDDAFYTLVREIRKDKEHRGKEKRRRLR GASSGRRRYRCCLL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaattagtggtagtgggtgctggtggtgttggcaagtccgcactcacc atacagctcatccaaaaccactttgtagatgaatatgatcctacgatagaagactcttat agaaaacaggttgttattgatggagagacgtgtctcttggatattcttgatactgctggt caagaggaatatagtgccatgagagatcagtatatgagaacaggagaaggctttcttttg gtctttgctgtaaattctgcaaagagttttgaggatatcggtacatacagagaacagata aagagggtaaaggatgccgaggaagttccaatggtcctggtgggaaacaaatgtgatcta cagcaatcatgggctgttaatatgacacaagcacgagaggtcgcgcggcagtacggtgta ccttttgtagaaacatctgcaaaaactagaatgggagtagacgatgccttctacactttg gtgcgagaaattcgaaaggataaggagcacagaggtaaggagaaacggaggagactgcgc ggtgccagttctggtcgtaggagatatcggtgttgcctgctctaa

DBGET integrated database retrieval system