KEGG   Cephus cinctus (wheat stem sawfly): 107272656
Entry
107272656         CDS       T07523                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
ccin  Cephus cinctus (wheat stem sawfly)
Pathway
ccin00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ccin00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    107272656
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ccin00199]
    107272656
Enzymes [BR:ccin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     107272656
Cytochrome P450 [BR:ccin00199]
 Cytochrome P450, animal type
  CYP306 family
   107272656
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107272656
NCBI-ProteinID: XP_015605508
LinkDB
Position
Unknown
AA seq 494 aa
MLLLLFILVALLLLPLAILRSTGHRQKRPPGPWGLPVIGYLPWIDSKAPHETLTNLTRRY
GPVCALKMGSVYTVLLSDPRLVRQVLAKDSFSGRAPLYLTHGIMGGYGLICAEGKLWREQ
RRFAVSCLKNLGMLKFGGKRDRLEARIIGAVDESVSKLSVHSGRQGVDPFETLHHCLGNL
MNRIVFGKDYREDDVVWKWLRHLQEEGVKHIGVAGPLNFLPILRLLPRFSKVFDYLIDGK
RKTHQVYKQIIAEHRNQVDNGEETMDSVLAAFDDEMRRRMNSDDPGHFTEPQFLHFLADL
FGASTDTTLATIRWFLLFMVAYPEEQLRIQQELDAVLRGKNVSLDDRSALPYLEAAIAET
QRIRSVVPVGIPHGTTEDTLIAGYEVPKGSMVVPLQWAIHMNPKYWQDPTKFKPERFIAQ
DGSLAKPEAFLPFQTGKRMCLGEDLAKMMLFLFTGRILQRLNLTSPEDQQLDLTGECGIT
MTPKPYRLIFTSRS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgctgctgcttctttttatcctcgtcgccctgcttcttctacctctggcaatactcagg
agcaccggacacaggcaaaagcgacctcctgggccctggggacttcctgtcatcggatat
ttaccctggatcgattccaaggcgcctcacgagacgctgaccaatctaacacgtcgatac
ggtcctgtctgtgctcttaaaatgggatccgtctacaccgttcttctatcagatcctcgt
ctggtgagacaggtcctcgccaaggactccttttccggtagagcgccactctatttaact
cacggcatcatgggtggttatggactgatatgcgccgaaggtaaactctggagggagcaa
cgtagattcgctgtgtcgtgcctgaagaatctgggaatgctgaaatttggaggtaaacgc
gatcgacttgaagcgagaataattggggccgtcgacgagagtgtatcgaaattatcggtg
cattccggtagacaaggtgtggatcccttcgagactttacatcactgcctgggtaatctg
atgaatcgcattgtctttggcaaggactaccgggaggacgacgtcgtgtggaagtggttg
cgtcatcttcaggaagaaggagtcaagcatatcggcgtggcagggccgcttaactttctg
ccgattctcaggctgcttccacgatttagtaaagtgtttgactatctgatcgatgggaag
cggaagactcatcaagtgtacaagcagatcatcgccgagcacaggaaccaggttgacaat
ggagaagagacgatggacagtgtcttggctgcgttcgacgatgagatgagacgtcggatg
aacagtgatgatcctggtcactttaccgaacctcagtttcttcattttctggcggatctc
tttggcgccagtacagacaccaccttggcgacgattcgctggttcctcctcttcatggtt
gcataccccgaggagcagctcaggattcagcaggagttggatgctgttcttcgagggaag
aatgtgtctctcgatgacagaagtgccttgccgtacctcgaagctgccatagcggaaact
caacgtatcaggagcgtcgtccccgtcggcatacctcacggaaccactgaggacacattg
atcgccggttacgaagttccaaagggaagcatggtggttcccttacagtgggctattcac
atgaatccgaaatactggcaggacccaacgaaattcaaaccggaaagattcatcgcccag
gacggaagtctcgccaagccagaagcttttcttccctttcagactggaaagcggatgtgc
ctcggcgaagatctagccaagatgatgctcttcctttttactggtcgaatcctccagagg
cttaacctaacctcacctgaagatcaacagctggacttgactggagagtgtggcataact
atgacaccgaaaccatatcgattaatattcacatctcgttcctaa

DBGET integrated database retrieval system