Cephus cinctus (wheat stem sawfly): 107274664 Help Entry 107274664         CDS       T07523                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism ccin  Cephus cinctus (wheat stem sawfly) Pathway ccin04814   Motor proteins Brite KEGG Orthology (KO) [BR:ccin00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     107274664  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccin03037]     107274664    04812 Cytoskeleton proteins [BR:ccin04812]     107274664 Cilium and associated proteins [BR:ccin03037]  Motile cilia and associated proteins   Dynein arm    107274664 Cytoskeleton proteins [BR:ccin04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      107274664 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  107274664 NCBI-ProteinID:  XP_015609478 UniProt:  A0AAJ7CGI9 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MEDMQEETQFVVDDVSKIIKEAIEVSIGGNAYQHSKVNQWTSHVVEGCLGNLTKLQKPYK YIVTCTIMQKNGAGLHTASSCFWDNATDGSCTVRWENKTMYCIVSVFGLAI NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaggatatgcaggaagagactcaatttgtagtggacgatgtgagcaaaatcatcaag gaagccatcgaggtatctattgggggtaatgcatatcaacatagcaaagtaaatcagtgg acatcacatgttgtggaaggttgtttgggaaatcttactaaattacagaagccttataaa tacatagtaacttgtacaattatgcaaaagaatggagcaggccttcatacagctagctct tgcttttgggacaatgctaccgatggaagttgcaccgttcgctgggaaaacaaaacaatg tattgcatagtttcagtctttgggctggctatctaa

DBGET integrated database retrieval system