Corynebacterium camporealensis: UL81_03660 Help Entry UL81_03660        CDS       T03923                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ccj  Corynebacterium camporealensis Brite KEGG Orthology (KO) [BR:ccj00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     UL81_03660 Enzymes [BR:ccj01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      UL81_03660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  AKE38707 UniProt:  A0A0F6QV89 LinkDB All DBs Position complement(765322..765603) Genome browser AA seq 93 aa AA seqDB search MSVSTPDTTEHVTVFYADWCPFCSKLRQDLAADGTPHALVDAEAEGTEDINEWIKSVNDG NRIVPTVLYSDGTTATNPAAADVRKKFEELDAS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgagcgttagcacccccgacactactgagcacgtcaccgttttctacgccgactggtgc ccgttctgctccaagctgcgccaggacctcgccgccgatggcaccccgcacgcgcttgtc gatgccgaggctgagggcaccgaggacatcaacgagtggatcaagtcggtcaacgacggc aaccgcatcgttccgaccgtgctgtattcggatggcaccactgccactaacccagcagct gccgatgtgcgcaagaagttcgaagagctagacgccagctaa

DBGET integrated database retrieval system