Corynebacterium camporealensis: UL81_08410 Help Entry UL81_08410        CDS       T03923                                  Name (GenBank) ribonuclease   KO K01167   ribonuclease T1 [EC:4.6.1.24] Organism ccj  Corynebacterium camporealensis Brite KEGG Orthology (KO) [BR:ccj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ccj03019]     UL81_08410    03016 Transfer RNA biogenesis [BR:ccj03016]     UL81_08410 Enzymes [BR:ccj01000]  4. Lyases   4.6  Phosphorus-oxygen lyases    4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)     4.6.1.24  ribonuclease T1      UL81_08410 Messenger RNA biogenesis [BR:ccj03019]  Prokaryotic type   Bacterial mRNA degradation factors    RNA degradosome components     Ribonucreases      UL81_08410 Transfer RNA biogenesis [BR:ccj03016]  Eukaryotic type   3'processing and CCA adding factors    3'processing factors     UL81_08410  Prokaryotic type     UL81_08410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribonuclease Motif Other DBs NCBI-ProteinID:  AKE39632 UniProt:  A0A0F6QWV7 LinkDB All DBs Position 1778753..1779052 Genome browser AA seq 99 aa AA seqDB search MESCSIDTLPEEASETADDILAGGPYDYPENDNQHFGNYEGVLPQQDNDYYREYTVETPG LNHRGPLRIVTGGGSETDPDVWYYTDDHYESFCEIPDAE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggaatcttgttccatcgatacgctgccggaggaggcctctgagactgccgatgacatc ttggcaggcgggccttatgactatccggaaaacgacaaccagcactttggcaactacgaa ggcgtgttgccacaacaagacaatgattattaccgcgaatacacggtggagactccgggg ctaaaccaccgcggtccgctgcgcatcgttaccggtggcggcagcgagaccgaccccgat gtctggtactacaccgacgaccactacgaatctttctgcgagatcccagatgccgaataa

DBGET integrated database retrieval system