KEGG   Corynebacterium crudilactis: ccrud_07075
Entry
ccrud_07075       CDS       T04829                                 
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
ccjz  Corynebacterium crudilactis
Pathway
ccjz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ccrud_07075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccjz02000]
    ccrud_07075
Enzymes [BR:ccjz01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     ccrud_07075
Transporters [BR:ccjz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    ccrud_07075
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase SMC_N nSTAND1 AAA_22 MMR_HSR1 AAA_16 AAA_33 NB-ARC Mg_chelatase AAA_23 DUF87
Other DBs
NCBI-ProteinID: ANE03993
UniProt: A0A172QTH5
LinkDB
Position
complement(1499959..1500774)
AA seq 271 aa
MKSDVSALPVATRSWAIEFDHVSVTYSNGTKALDDISLTINPGEMVAIVGLSGSGKSTLI
RTINGLVPVTAGSVTVGPHQINALSGKTLRTARGQIGMIFQGFNLSERSTVFHNVLVGRF
AHTAWWRNLLGRPTAEDKSIAFHALDAVGILDKAWVRAHALSGGQKQRVAIARALSQDPS
VMLADEPVASLDPPTAHSVMRDLEHINNSEGITVLVNLHLIDLARQYTTRLIGLRAGKLV
YDGLVADATDADFEAIYGRPIQAKDLLGERE
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaaatctgatgtttcggctcttcctgtggcaacgaggtcttgggctattgagttcgat
cacgtgtcggtgacatattccaacggaacgaaagcgctggatgatatttcgctgacgatt
aatccgggtgagatggtggcgatagttggtttgtctggatctggaaagtccacgttgatc
cgcacgatcaatgggctggttccggtgacagcaggcagcgtcacggtggggccacatcag
atcaatgccttgtctgggaaaacacttcgcacagcgcgtggccaaataggcatgattttc
caaggctttaacctgtctgaacgcagtaccgtgttccacaatgtgttggtggggcgcttt
gcacacaccgcgtggtggcgtaacctgcttggccgtcccaccgcggaggataaatcaatt
gctttccacgcacttgatgcagtgggcattttagataaagcatgggtgcgtgcacatgct
ttatcaggaggacaaaagcagcgcgtggctattgctcgcgccctctcccaagacccttca
gtcatgctggctgatgaacctgtggcaagtttggatccccctacagcgcactcggtgatg
cgcgacctggaacatatcaacaactctgagggcatcactgtgctggtgaatttgcactta
attgatttggctcgccagtacaccacacggttgattggtttgcgcgccgggaagttggtg
tatgacggtcttgtcgctgatgccactgatgcggattttgaggctatttatggccgtccc
attcaggcgaaggatttgttgggtgagcgtgaatga

DBGET integrated database retrieval system