Coregonus clupeaformis (lake whitefish): 121533215 Help Entry 121533215         CDS       T08357                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04010   MAPK signaling pathway cclu04068   FoxO signaling pathway cclu04081   Hormone signaling cclu04114   Oocyte meiosis cclu04140   Autophagy - animal cclu04150   mTOR signaling pathway cclu04810   Regulation of actin cytoskeleton cclu04910   Insulin signaling pathway cclu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     121533215    04150 mTOR signaling pathway     121533215   09133 Signaling molecules and interaction    04081 Hormone signaling     121533215  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121533215  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cclu04052]     121533215 Cytokines and neuropeptides [BR:cclu04052]  Neuropeptides   Unclassified    121533215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  121533215 NCBI-ProteinID:  XP_041694969 LinkDB All DBs Position 2:complement(12420321..12423146) Genome browser AA seq 115 aa AA seqDB search MAVVLWALSVLLLLVLSSPGVCSAPSAQHLCGSHLVDALYLVCGEQGFFYIPHRSPRDLL LQHLIGFLSKRSRQGWRVKQERPWKDHEDQKVKRGIVEQCCHQPCSFSHLQSYCD NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggctgtggtactatgggcactgtctgttctgttactgctggtcctgtcatcccccggg gtctgctcagcccccagcgcccagcacctgtgtggctctcacctggtggatgccctctac ctggtctgtggggaacaagggttcttctatatcccccacagatcccccagagacctactc ctgcaacacctcatagggttcctgtctaagaggagcagacagggttggagggtgaagcag gaacgtccatggaaggaccatgaagaccagaaggtgaagagaggcattgtggaacagtgc tgtcatcagccatgtagcttcagccacctgcagagctactgcgactga

DBGET integrated database retrieval system