Coregonus clupeaformis (lake whitefish): 121536500 Help Entry 121536500         CDS       T08357                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04814   Motor proteins cclu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cclu00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     121536500  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121536500  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cclu03037]     121536500    04812 Cytoskeleton proteins [BR:cclu04812]     121536500 Cilium and associated proteins [BR:cclu03037]  Motile cilia and associated proteins   Dynein arm    121536500 Cytoskeleton proteins [BR:cclu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      121536500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  121536500 NCBI-ProteinID:  XP_041699759 LinkDB All DBs Position 23:complement(3976053..3980731) Genome browser AA seq 115 aa AA seqDB search MEEYNSGEEVSFNADEASVSVKECIEGIIGGIDYNQNKVNQWTASIVEHSLTQLVKQGRP FKFIVNCAIMQKSGAGLHTANSCYWDTATDGSCTVRWENRTMYCVVSVFAVAVTC NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtacaattccggagaggaggtgtccttcaacgcagatgaggccagtgtctct gttaaagagtgtatcgaaggtatcattggaggaatagactacaaccagaacaaagtgaac cagtggactgccagcatcgtggagcactctctcacccagctggtcaagcaagggagacca ttcaagttcatagtgaactgtgccatcatgcagaagagtggtgctggtctccacacggct aactcctgctactgggacactgctactgatggaagctgcacggtcaggtgggagaaccgc accatgtactgtgtggtgagtgttttcgccgtggccgtgacctgttaa

DBGET integrated database retrieval system