Coregonus clupeaformis (lake whitefish): 121542941 Help Entry 121542941         CDS       T08357                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04068   FoxO signaling pathway cclu04136   Autophagy - other cclu04140   Autophagy - animal cclu04621   NOD-like receptor signaling pathway cclu04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     121542941  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121542941    04136 Autophagy - other     121542941  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cclu04131]     121542941    04121 Ubiquitin system [BR:cclu04121]     121542941    03029 Mitochondrial biogenesis [BR:cclu03029]     121542941 Membrane trafficking [BR:cclu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     121542941 Ubiquitin system [BR:cclu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    121542941 Mitochondrial biogenesis [BR:cclu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     121542941 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 XendoU Motif Other DBs NCBI-GeneID:  121542941 NCBI-ProteinID:  XP_041708516 LinkDB All DBs Position 17:69914905..69918264 Genome browser AA seq 120 aa AA seqDB search MSDNAESPTETQKDEPSTPQQPTEDSGTADEKKKIDVLLKAVGDTPIMKTKKWSVEKGRT VQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaatgctgagtcgcctacagaaacgcaaaaagatgagccttcaaccccacaa cagcctacggaagactcggggacggcagacgagaagaaaaaaattgatgtgttgttgaag gcagtaggagacacccccatcatgaagacgaagaaatggtcggtagagaaagggaggaca gtgcaatcgctctctcagttcatctctcgattcctcaagatggaggccaatgaacagctg ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggagtcctgttt gaatgttttggcagcgatgggaagctggttctacattactgtaaatctcaagcctggggt taa

DBGET integrated database retrieval system