Coregonus clupeaformis (lake whitefish): 121543193 Help Entry 121543193         CDS       T08357                                  Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04382   Cornified envelope formation cclu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cclu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121543193  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121543193  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     121543193 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of microglial cells    121543193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EH Astro_p19 DEK_C Motif Other DBs NCBI-GeneID:  121543193 NCBI-ProteinID:  XP_041708835 LinkDB All DBs Position 17:complement(550701..554317) Genome browser AA seq 101 aa AA seqDB search MPSQLESSMESLIKVFHRYADKDGDCNTLSKKELKELMQTELASFLKSQKDPAAIDKIMK DLDQNGDGKVNFEEFVSLVVGLSIACEQIYQLHTMKSTAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagttccatggagtccctgatcaaggtgttccatcgctatgcc gacaaggacggtgactgcaacacactgagcaagaaggagctgaaagaactcatgcagaca gaactggccagcttcctcaagtcccagaaggacccagccgccatagacaagatcatgaag gatctggaccagaatggagatgggaaggtgaacttcgaggagtttgtctctctggtggtg ggcctctccatcgcctgtgaacagatctaccagcttcacaccatgaagtctaccgccaag aaatga

DBGET integrated database retrieval system