Coregonus clupeaformis (lake whitefish): 121548165 Help Entry 121548165         CDS       T08357                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04020   Calcium signaling pathway cclu04070   Phosphatidylinositol signaling system cclu04114   Oocyte meiosis cclu04218   Cellular senescence cclu04261   Adrenergic signaling in cardiomyocytes cclu04270   Vascular smooth muscle contraction cclu04371   Apelin signaling pathway cclu04625   C-type lectin receptor signaling pathway cclu04744   Phototransduction cclu04910   Insulin signaling pathway cclu04912   GnRH signaling pathway cclu04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     121548165    04020 Calcium signaling pathway     121548165    04070 Phosphatidylinositol signaling system     121548165  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121548165    04218 Cellular senescence     121548165  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121548165   09152 Endocrine system    04910 Insulin signaling pathway     121548165    04912 GnRH signaling pathway     121548165    04916 Melanogenesis     121548165   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121548165    04270 Vascular smooth muscle contraction     121548165   09157 Sensory system    04744 Phototransduction     121548165  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cclu01009]     121548165   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cclu04131]     121548165    03036 Chromosome and associated proteins [BR:cclu03036]     121548165   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     121548165 Protein phosphatases and associated proteins [BR:cclu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121548165 Membrane trafficking [BR:cclu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121548165 Chromosome and associated proteins [BR:cclu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121548165 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121548165 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 CFAP251_C EF-hand_5 EF-hand_11 EF-hand_EFHB_C EAP30 EFhand_Ca_insen GPHH CCM1_C Motif Other DBs NCBI-GeneID:  121548165 NCBI-ProteinID:  XP_041715448 LinkDB All DBs Position 32:complement(1889809..1896652) Genome browser AA seq 153 aa AA seqDB search MAKFLSGTQINEFKECFSLYDKKRKGKIEAKDLITVMRCLGTSPTFGEIDRHLQVHKIDK KGELDFSTFLTMMHRQIQQEDPKAEILEAMRMTDKQNKGYILASELRTKLTKLGEKLTDK EVDELFREANVKSNGKVHYEEFTRMVTLPSVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaaattcctgtcaggaactcagatcaacgagttcaaggaatgtttctccttgtat gacaagaagcgcaaggggaagattgaagccaaggacctgatcacagttatgcgctgtctg gggacgagtcccaccttcggcgagatcgacagacacctgcaggtccacaagatagataag aagggcgagctggacttctccaccttcctgaccatgatgcaccggcagatccagcaggag gaccccaaggcggagatcctggaggccatgaggatgacggacaagcagaacaagggctac atcctggcttctgagctccggaccaagctcaccaagctaggagagaagctaactgataaa gaagtggacgagctgttcagagaagccaacgtgaagtctaatggcaaggtgcactacgag gagttcaccaggatggtgacactaccgtcagtggattactga

DBGET integrated database retrieval system