Coregonus clupeaformis (lake whitefish): 121561811 Help Entry 121561811         CDS       T08357                                  Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu03410   Base excision repair cclu04140   Autophagy - animal cclu04217   Necroptosis Brite KEGG Orthology (KO) [BR:cclu00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     121561811  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121561811   09143 Cell growth and death    04217 Necroptosis     121561811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cclu03036]     121561811    03400 DNA repair and recombination proteins [BR:cclu03400]     121561811   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     121561811 Chromosome and associated proteins [BR:cclu03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     121561811 DNA repair and recombination proteins [BR:cclu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      121561811    MMR (mismatch excision repair)     Other MMR factors      121561811 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121561811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 HMG_box_5 Motif Other DBs NCBI-GeneID:  121561811 NCBI-ProteinID:  XP_041730194 LinkDB All DBs Position 5:19937754..19940502 Genome browser AA seq 194 aa AA seqDB search MGKDPRKPRGKMSSYAYFVQTCRAEHKKKHPEASVNFSEFSKKCSERWKPMSPKEKGKFE DMAKQDKVRYEREMKNYIPPNGQKKKRFKDPNAPKRPPSAFFVFCADFRAKIKSEHPGLS IGDTAKKLGVMWNSSAAEEKKPYEKKAATLKEKYDKDIASYRTNGRVDTASSAAADDDDE EEDEEDDDDEDDDE NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggggaaagatcctaggaaaccgagaggcaagatgtcatcatatgcttacttcgtgcag acctgcagggctgagcacaagaagaaacaccccgaagccagcgtgaacttctctgagttc tccaagaaatgctcagagcgatggaagcccatgtctcctaaagagaaaggcaagtttgaa gacatggcgaagcaagacaaggtccgctacgagagagaaatgaagaactacatcccaccc aatggccagaaaaagaagaggttcaaggatcctaatgcccccaagagaccgccgtctgca ttcttcgtcttctgtgctgacttccgggccaagataaagagtgagcacccaggtctgtcc atcggagacactgctaagaagctgggagtgatgtggaacagctctgcagctgaggagaag aagccatacgagaagaaggcagccacgctgaaggagaaatacgacaaggatatcgcctca taccgcaccaatggtagagtggatacggcctcctccgcagctgctgatgatgacgacgaa gaggaggatgaggaggatgacgacgatgaggatgatgacgagtag

DBGET integrated database retrieval system