Coregonus clupeaformis (lake whitefish): 121568946 Help Entry 121568946         CDS       T08357                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cclu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     121568946 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cclu04121]     121568946 (elob)    03400 DNA repair and recombination proteins [BR:cclu03400]     121568946 (elob) Ubiquitin system [BR:cclu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      121568946 (elob)    Cul5 complex      121568946 (elob) DNA repair and recombination proteins [BR:cclu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      121568946 (elob) BRITE hierarchy Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  121568946 NCBI-ProteinID:  XP_041735377 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTTNEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcacaagacgaccatcttcactgatgccaaagag tccactacggtctacgagctgaagcgcatagtggagggtattctaaagagggcaccggag gaacagaggctctacaaggatgacatgttgctggaggatagtaagactcttggagactgt ggcttcacaaaccagacagccagacctcaagccccagggactgttggattagctttccgt ctcggggatgatgcatttgagcagctgagggttgagcccttctccagccccccagagctc cctgacgtcatgaagcctcaggactctggcagcacaaccaatgagcaggccgtgcagtga

DBGET integrated database retrieval system