Coregonus clupeaformis (lake whitefish): 121574459 Help Entry 121574459         CDS       T08357                                  Name (RefSeq) insulin   KO K04526   insulin Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04010   MAPK signaling pathway cclu04068   FoxO signaling pathway cclu04081   Hormone signaling cclu04114   Oocyte meiosis cclu04140   Autophagy - animal cclu04150   mTOR signaling pathway cclu04810   Regulation of actin cytoskeleton cclu04910   Insulin signaling pathway cclu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121574459    04068 FoxO signaling pathway     121574459    04150 mTOR signaling pathway     121574459   09133 Signaling molecules and interaction    04081 Hormone signaling     121574459  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121574459   09143 Cell growth and death    04114 Oocyte meiosis     121574459   09142 Cell motility    04810 Regulation of actin cytoskeleton     121574459  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     121574459    04914 Progesterone-mediated oocyte maturation     121574459  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cclu04052]     121574459 Cytokines and neuropeptides [BR:cclu04052]  Neuropeptides   Unclassified    121574459 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  121574459 NCBI-ProteinID:  XP_041743011 LinkDB All DBs Position 9:52311926..52315789 Genome browser AA seq 105 aa AA seqDB search MAFWLQVASLLVLLALSPGADAAAAQHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLIGF LSPKSVQENEEYPFKDEMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccttctggctccaagttgcgtctctgctggtgctgctggccctctcccccggggca gacgctgcagctgcccagcacctgtgtggctctcacctggtggacgccctctatctggtg tgtggagagaaaggattcttttacaacccaaagagagatgtggatccccttatagggttc ctctctccaaaatcggtccaggagaacgaagagtaccccttcaaagacgagatggagatg atggtaaagcgaggtattgtagagcagtgctgtcacaagccctgcaacatcttcgacctg cagaactactgcaactga

DBGET integrated database retrieval system