Coregonus clupeaformis (lake whitefish): 121574887 Help Entry 121574887         CDS       T08357                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04810   Regulation of actin cytoskeleton cclu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cclu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121574887  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121574887 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  121574887 NCBI-ProteinID:  XP_041743488 LinkDB All DBs Position 10:10145981..10148469 Genome browser AA seq 75 aa AA seqDB search MSGQDDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtccggccaggatgacccagttcaaagagaaatccaccaggattgggcaaatcgcgag tatatagaagtgatcacgagtagcatcaagaagattgccgatttcctaaattcatttgat atgtcctgtcggtcccggttagccactcttaatgagaagctaactgccttggagaggagg attgaatacattgaggcaagggttactaaaggcgaaaccttgacctag

DBGET integrated database retrieval system