Coregonus clupeaformis (lake whitefish): 121576390 Help Entry 121576390         CDS       T08357                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04010   MAPK signaling pathway cclu04012   ErbB signaling pathway cclu04068   FoxO signaling pathway cclu04137   Mitophagy - animal cclu04140   Autophagy - animal cclu04144   Endocytosis cclu04150   mTOR signaling pathway cclu04210   Apoptosis cclu04218   Cellular senescence cclu04370   VEGF signaling pathway cclu04371   Apelin signaling pathway cclu04510   Focal adhesion cclu04540   Gap junction cclu04625   C-type lectin receptor signaling pathway cclu04810   Regulation of actin cytoskeleton cclu04910   Insulin signaling pathway cclu04912   GnRH signaling pathway cclu04916   Melanogenesis cclu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121576390    04012 ErbB signaling pathway     121576390    04370 VEGF signaling pathway     121576390    04371 Apelin signaling pathway     121576390    04068 FoxO signaling pathway     121576390    04150 mTOR signaling pathway     121576390  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121576390    04140 Autophagy - animal     121576390    04137 Mitophagy - animal     121576390   09143 Cell growth and death    04210 Apoptosis     121576390    04218 Cellular senescence     121576390   09144 Cellular community - eukaryotes    04510 Focal adhesion     121576390    04540 Gap junction     121576390   09142 Cell motility    04810 Regulation of actin cytoskeleton     121576390  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121576390   09152 Endocrine system    04910 Insulin signaling pathway     121576390    04912 GnRH signaling pathway     121576390    04916 Melanogenesis     121576390  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121576390  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cclu04131]     121576390   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     121576390    04031 GTP-binding proteins [BR:cclu04031]     121576390 Membrane trafficking [BR:cclu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     121576390  Endocytosis   Macropinocytosis    Ras GTPases     121576390 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    121576390   Exosomal proteins of colorectal cancer cells    121576390 GTP-binding proteins [BR:cclu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121576390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  121576390 NCBI-ProteinID:  XP_041745421 LinkDB All DBs Position 11:complement(9242524..9286181) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtagtggtgggggctggaggtgtggggaagagtgcactcacc atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggaacagatc aagcgtgtgaaggactctgatgacgtacccatggtgctagtgggtaataaatgtgacctc ccggcacgtactgtggacacgcggcaagcacaggaactggcccgcagctatggaattccc tacatcgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc agagagatcaggcagcacaagctgaggaagctcaaccctcctgacgagagtggacaggac tgcatgagctgccgatgtgtggtgtcatga

DBGET integrated database retrieval system