Coregonus clupeaformis (lake whitefish): 121578211 Help Entry 121578211         CDS       T08357                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04137   Mitophagy - animal cclu04140   Autophagy - animal cclu04144   Endocytosis cclu04145   Phagosome cclu04148   Efferocytosis cclu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cclu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121578211    04145 Phagosome     121578211    04140 Autophagy - animal     121578211    04137 Mitophagy - animal     121578211    04148 Efferocytosis     121578211  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121578211  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cclu04131]     121578211   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     121578211    04031 GTP-binding proteins [BR:cclu04031]     121578211 Membrane trafficking [BR:cclu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121578211 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121578211   Exosomal proteins of other body fluids (saliva and urine)    121578211   Exosomal proteins of colorectal cancer cells    121578211   Exosomal proteins of bladder cancer cells    121578211 GTP-binding proteins [BR:cclu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121578211 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  121578211 NCBI-ProteinID:  XP_041748346 LinkDB All DBs Position 12:41028720..41037145 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERANPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatctaggaagaaagtactacttaaagtcatcattctgggagactctggagttggg aagacctcgctgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggagctgatttcctgacgaaagaagtgatggtggatgacaggcttgttaccatgcag atctgggacacagcggggcaggagaggttccagtctctgggcgtggcgttctaccgcggg gcagactgttgtgtgctggtgtttgacgtgaccgcccccaacaccttcaagactctagac agctggagggacgagttcctcatccaggccagcccgcgagatcctgagaacttccccttt gtggtgctaggcaacaagattgacctggagaacagacaggtgacgactaaacgagcacag gcctggtgtcagagcaagaacaacatcccctacttcgagaccagcgctaaggaggccatc aacgttgaacaggctttccagactatcgcacgcaatgctcttaaacaggagacagaggtg gagttgtacaatgagttccctgaaccgataaagctggacaggaacgaacgggccaaccca tcagcggaggcctgcagctgctga

DBGET integrated database retrieval system