Coregonus clupeaformis (lake whitefish): 121578496 Help Entry 121578496         CDS       T08357                                  Name (RefSeq) calglandulin-like   KO K02183   calmodulin Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04020   Calcium signaling pathway cclu04070   Phosphatidylinositol signaling system cclu04114   Oocyte meiosis cclu04218   Cellular senescence cclu04261   Adrenergic signaling in cardiomyocytes cclu04270   Vascular smooth muscle contraction cclu04371   Apelin signaling pathway cclu04625   C-type lectin receptor signaling pathway cclu04744   Phototransduction cclu04910   Insulin signaling pathway cclu04912   GnRH signaling pathway cclu04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     121578496    04020 Calcium signaling pathway     121578496    04070 Phosphatidylinositol signaling system     121578496  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121578496    04218 Cellular senescence     121578496  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121578496   09152 Endocrine system    04910 Insulin signaling pathway     121578496    04912 GnRH signaling pathway     121578496    04916 Melanogenesis     121578496   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121578496    04270 Vascular smooth muscle contraction     121578496   09157 Sensory system    04744 Phototransduction     121578496  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cclu01009]     121578496   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cclu04131]     121578496    03036 Chromosome and associated proteins [BR:cclu03036]     121578496   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     121578496 Protein phosphatases and associated proteins [BR:cclu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121578496 Membrane trafficking [BR:cclu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121578496 Chromosome and associated proteins [BR:cclu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121578496 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121578496 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 AIF-1 EF-hand_8 EF_EFCAB10_C EH Motif Other DBs NCBI-GeneID:  121578496 NCBI-ProteinID:  XP_041748793 LinkDB All DBs Position 12:47816273..47821211 Genome browser AA seq 143 aa AA seqDB search MSVYISSNALSQEQITEYKGVFEMFDEEGNGTVKTQELERLMNFMGINPTKRELLQMAKD VDKDGKGTFNRESFLGLMALVHESAKGQDAVQRAAFKVFDEEAKGYIEWNTLNFCLESVF WCAQCIPNASADLSPERDNQWLL NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgtacatctcctcaaatgctttatcacaagaacagatcactgagtataaaggt gtttttgaaatgtttgatgaggaaggaaatggaacagtgaagacacaggagctggagcga ctgatgaactttatgggaatcaatcccaccaagagagagctccttcagatggccaaagat gtggataaagatggcaaaggtacttttaaccgtgagagcttcctgggtttgatggcattg gtccacgaaagcgcgaagggccaagatgctgtgcaacgagctgctttcaaggtgtttgac gaagaggccaagggatatattgagtggaataccctgaatttctgcctggagagtgtgttc tggtgtgctcaatgcattcccaatgcttcagcagacctcagtccagagagagacaaccag tggctgttatga

DBGET integrated database retrieval system