Coregonus clupeaformis (lake whitefish): 121583133 Help Entry 121583133         CDS       T08357                                  Name (RefSeq) myosin light chain 5-like   KO K12753   myosin regulatory light chain 5 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04510   Focal adhesion cclu04520   Adherens junction cclu04810   Regulation of actin cytoskeleton cclu04814   Motor proteins cclu04820   Cytoskeleton in muscle cells cclu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cclu00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     121583133    04520 Adherens junction     121583133   09142 Cell motility    04814 Motor proteins     121583133    04820 Cytoskeleton in muscle cells     121583133    04810 Regulation of actin cytoskeleton     121583133  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121583133  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cclu04812]     121583133 Cytoskeleton proteins [BR:cclu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      121583133 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 Caleosin Lactamase_B_5 Motif Other DBs NCBI-GeneID:  121583133 NCBI-ProteinID:  XP_045081385 LinkDB All DBs Position 15:complement(46841916..46844907) Genome browser AA seq 133 aa AA seqDB search MGKNVQCASRKTKKKEWGAKRAQRASSNVFSMFEQTQIQEFKEAFTLIDQDRDGFIDKED LKDTFASLGQYFNDTLNGQKYVDTPSKPGYCTDICLQTFQVKQMFQSSTFDPARNLDYKS LCYIITHGEGQEE NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaaatgttcagtgcgccagcagaaagaccaagaagaaggaatggggtgccaag agagcccagagagcatcctccaatgtcttctccatgttcgagcagacacagatccaggag ttcaaagaggcgttcacacttatcgaccaggacagagatgggttcattgacaaagaagat ctgaaggatacctttgcatctcttggtcagtatttcaatgatacactaaatggccaaaag tatgtggacaccccttcaaaacccggatactgtactgatatttgtctgcaaacctttcag gttaagcagatgttccaatcgtctaccttcgacccagcaagaaacctggactacaaatcc ctctgttacatcatcacccacggggagggacaggaggagtaa

DBGET integrated database retrieval system