Coregonus clupeaformis (lake whitefish): 121583192 Help Entry 121583192         CDS       T08357                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu03030   DNA replication cclu03082   ATP-dependent chromatin remodeling cclu03410   Base excision repair cclu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cclu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     121583192 (pole3)    03410 Base excision repair     121583192 (pole3)    03420 Nucleotide excision repair     121583192 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     121583192 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cclu03032]     121583192 (pole3)    03036 Chromosome and associated proteins [BR:cclu03036]     121583192 (pole3)    03400 DNA repair and recombination proteins [BR:cclu03400]     121583192 (pole3) Enzymes [BR:cclu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      121583192 (pole3) DNA replication proteins [BR:cclu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     121583192 (pole3) Chromosome and associated proteins [BR:cclu03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     121583192 (pole3) DNA repair and recombination proteins [BR:cclu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       121583192 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP PPP4R2 SpoU_methylase DUF4746 RNA_pol_3_Rpc31 NOA36 Pox_Ag35 CDC45 PFF1_TM DDHD Motif Other DBs NCBI-GeneID:  121583192 NCBI-ProteinID:  XP_041755320 LinkDB All DBs Position 15:6982533..6989998 Genome browser AA seq 146 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNATDVMSAMEEMEFERFLQPLRESLEAYKKGQKGKKEASEQKRKDAKEKKNDKSRE EEEEEEERMEEDQEAENEVEEEEVEN NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggcagaaagacccgaggacctcaatctacccaatgctgtcatcacgcgcatcatcaag gaggcgctaccagatggggtgaacgtgtcaaaagaagccaggcgagccatatctcaagct gccagtgtattcgtcctctatgcaacatcttgtgcaaacaactttgccatgaaagccaaa cggaaaactctaaacgcaacagatgtgatgtctgcgatggaggagatggagtttgaacgc ttcttgcagcctctacgtgaatctttggaggcttacaagaagggccagaaggggaagaaa gaggcatcggaacaaaaacgcaaagacgcaaaggagaaaaagaacgacaagagcagggag gaggaagaggaggaggaagagcgcatggaggaagaccaggaagcagagaatgaggttgaa gaggaagaagttgagaattga

DBGET integrated database retrieval system