Coregonus clupeaformis (lake whitefish): 121584229 Help Entry 121584229         CDS       T08357                                  Name (RefSeq) C-C motif chemokine 28-like   KO K05513   C-C motif chemokine 28 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04060   Cytokine-cytokine receptor interaction cclu04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121584229  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     121584229  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cclu04052]     121584229 Cytokines and neuropeptides [BR:cclu04052]  Cytokines   Chemokines    121584229 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  121584229 NCBI-ProteinID:  XP_041755993 LinkDB All DBs Position 16:52251781..52255313 Genome browser AA seq 93 aa AA seqDB search MDLRVMAMLLFLCALAITTTEGGIPKCCVKASMDIPTYLLRKVERAEMQRNNGACEINAL VLHVQGKRLCAHPKVKRKLKRVQRRKGGKQTGQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggatcttcgagtgatggcaatgcttctctttctgtgtgctctggccatcacaaccact gaaggtggcattcctaagtgctgtgtgaaggcatctatggacattcctacctatctgctg aggaaggtagagagagcagagatgcagagaaacaatggtgcctgtgagatcaacgcactt gtactgcatgtgcaagggaagaggctctgtgcccacccaaaggtaaagagaaagctgaag agggtccagagaagaaagggcggaaaacagacggggcagtag

DBGET integrated database retrieval system