Coregonus clupeaformis (lake whitefish): 123488878 Help Entry 123488878         CDS       T08357                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism cclu  Coregonus clupeaformis (lake whitefish) Brite KEGG Orthology (KO) [BR:cclu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cclu03036]     123488878   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     123488878 Chromosome and associated proteins [BR:cclu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123488878 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123488878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  123488878 NCBI-ProteinID:  XP_045075552 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MPEPAKSAPKKGSKKAVTKTAGKGGKKRESQEGELRHLRVQGPEAGPPDTGISSKAMGIM NCVRERHLRAIAESLSLAHYNKRSTITSREIQTAVRLLSG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccagcaaagtcagcgcccaagaagggctccaagaaagccgtcaccaagacc gcagggaagggcggcaagaagcgagaaagtcaggaaggagagttacgccatctacgtgta caaggtcctgaagcaggtccacccgacaccggcatctcctccaaggccatgggaatcatg aactgcgttcgtgaacgacatcttcgagcgatcgcggagagtctctcgctggcccactac aacaagcgttctaccatcacctccagggagatccagaccgccgtgcgcctgctgtccggg tga

DBGET integrated database retrieval system