Coregonus clupeaformis (lake whitefish): 123489734 Help Entry 123489734         CDS       T08357                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu03082   ATP-dependent chromatin remodeling cclu04217   Necroptosis Brite KEGG Orthology (KO) [BR:cclu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     123489734  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123489734  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cclu03036]     123489734   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     123489734 Chromosome and associated proteins [BR:cclu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123489734 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123489734 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  123489734 NCBI-ProteinID:  XP_045076084 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MSGGVDSRQGEQRHRALKRAFNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAVKAK NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgtcggggggggtcgacagccgccaaggggaacagcgacacagagctctgaaaagagct tttaactacgccgagcgtgtgggcgctggcgcaccagtctacctggctgccgtgctcgag tacctgactgctgagatcctggagttggccggcaacgctgcccgtgacaacaagaagact cgtatcatcccccgtcacctgcagctggccgtccgtaacgacgaggagctaaacaaactg ctcggcggtgtgaccatcgctcagggtggtgtgctgcccaacatccaggcagtgctactc cccaagaagaccgagaaggcagtcaaagccaagtaa

DBGET integrated database retrieval system