Coregonus clupeaformis (lake whitefish): 14842639 Help Entry 14842639          CDS       T08357                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu00190   Oxidative phosphorylation cclu01100   Metabolic pathways Module cclu_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:cclu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     14842639 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cclu03029]     14842639 (ND4L) Enzymes [BR:cclu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      14842639 (ND4L) Mitochondrial biogenesis [BR:cclu03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     14842639 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  14842639 NCBI-ProteinID:  YP_007626870 UniProt:  H9E1S1 LinkDB All DBs Position MT:10068..10364 Genome browser AA seq 98 aa AA seqDB search MTPVHFSFTSAFVLGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacaccagtacacttcagctttacctcagcctttgttctaggactgataggactcgca ttccaccgcacccaccttctctcagcccttctttgcctagaaggaataatactctctcta tttattgccctatccctctgggcacttcaaatagaagcaaccggttattcggtagcccct atgctgttgctagccttctcagcctgtgaagccagcgcaggcctggccctactagtagca actgcacggacacacggtacggaccgcctccaaagcctcaaccttctccaatgttaa

DBGET integrated database retrieval system