Corynebacterium callunae: H924_04040 Help Entry H924_04040        CDS       T02507                                  Name (GenBank) hypothetical protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ccn  Corynebacterium callunae Brite KEGG Orthology (KO) [BR:ccn00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     H924_04040 Enzymes [BR:ccn01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      H924_04040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 AhpC-TSA GST_N_2 Thioredoxin_9 Thioredoxin Motif Other DBs NCBI-ProteinID:  AGG66254 UniProt:  M1UK22 LinkDB All DBs Position complement(867626..867865) Genome browser AA seq 79 aa AA seqDB search MSNVTIYATDWCPYCKALLRGLEGQEFDLIDVDQDEEAGEWVKSVNNGNRVVPTVLFSDG THATNPPAAEVIAKLEALA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaatgtaaccatctacgccaccgactggtgcccttactgcaaagcactgctgcgc ggacttgaaggccaggaatttgatctcatcgacgtcgatcaagacgaagaggctggcgaa tgggtgaaatccgtcaacaatggcaaccgtgtggttcctaccgtgctgttttcagatggc acccacgctactaatcctccagctgctgaggttattgccaagcttgaggcgctggcttag

DBGET integrated database retrieval system