Campylobacter concisus 13826: CCC13826_2174 Help Entry CCC13826_2174     CDS       T00593                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cco  Campylobacter concisus 13826 Pathway cco01100   Metabolic pathways cco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cco00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCC13826_2174    00074 Mycolic acid biosynthesis     CCC13826_2174   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCC13826_2174 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  EAT98454 UniProt:  A7ZFF5 LinkDB All DBs Position complement(1694183..1694428) Genome browser AA seq 81 aa AA seqDB search MSEVEIFEILKKALIELFEIDESKIKPETRIYEDLQIDSIDAIDMIDYIKRQTGYRLMPE DFKNVKTLDDIVKAVAKKFEA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagtagaaatttttgaaattttaaagaaggctttgatcgagctttttgagata gacgagagcaagataaagcctgaaactaggatatatgaggacttgcagatagatagtata gatgctattgatatgattgattatatcaagcgccaaactggctatagactgatgccagag gactttaaaaacgtaaaaacgcttgatgatatcgtaaaagccgtagcaaagaaatttgaa gcataa

DBGET integrated database retrieval system