Campylobacter concisus ATCC 33237: CCON33237_0816 Help Entry CCON33237_0816    CDS       T04635                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ccoc  Campylobacter concisus ATCC 33237 Brite KEGG Orthology (KO) [BR:ccoc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccoc03032]     CCON33237_0816 (hup)    03036 Chromosome and associated proteins [BR:ccoc03036]     CCON33237_0816 (hup)    03400 DNA repair and recombination proteins [BR:ccoc03400]     CCON33237_0816 (hup) DNA replication proteins [BR:ccoc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CCON33237_0816 (hup) Chromosome and associated proteins [BR:ccoc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CCON33237_0816 (hup) DNA repair and recombination proteins [BR:ccoc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CCON33237_0816 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  ALF47501 UniProt:  A0A0M4TMN7 LinkDB All DBs Position complement(814351..814653) Genome browser AA seq 100 aa AA seqDB search MKKAEFIQAVADKAGLSKKDTLKVVDATLETIQAVLEKGDTISFIGFGTFGTADRAARKA RVPGTKKVIDVPASKAVKFKVGKKLKEAVAAGAAKKGKKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaagctgaatttattcaagctgttgccgataaggctggtctttcaaaaaaagat actctaaaagttgttgatgctactttggagacaatccaagcagttcttgaaaaaggcgat acaattagctttataggctttggtactttcggtactgctgacagagctgcaagaaaagct agagttcctggaactaaaaaagttatcgacgttcctgctagcaaagcagttaaattcaaa gttggcaaaaaacttaaagaagcagttgctgctggtgctgctaaaaaaggtaaaaagaaa taa

DBGET integrated database retrieval system