Campylobacter concisus ATCC 33237: CCON33237_1570 Help Entry CCON33237_1570    CDS       T04635                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccoc  Campylobacter concisus ATCC 33237 Pathway ccoc01100   Metabolic pathways ccoc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccoc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCON33237_1570 (acpP)    00074 Mycolic acid biosynthesis     CCON33237_1570 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCON33237_1570 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF5805 Motif Other DBs NCBI-ProteinID:  ALF48219 UniProt:  A0A0M4TN77 LinkDB All DBs Position complement(1569061..1569294) Genome browser AA seq 77 aa AA seqDB search MAVFEDVRDVVVEQLSVDPQAVKLESKIIEDLGADSLDVVELVMALEEKFEVEIPDSEAE KLISIKDVVDYIEKLGK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaagacgtaagagacgtagttgtagagcaactaagtgtagatccacaa gcagtgaaactagagtctaaaattatcgaagacctaggtgcagattcacttgacgttgta gagctagttatggctttagaagaaaaatttgaagtagaaattcctgatagcgaagcagag aaattaataagcatcaaagacgttgtagattatatagaaaaactaggtaaataa

DBGET integrated database retrieval system