Campylobacter coli FB1: VC76_04660 Help Entry VC76_04660        CDS       T03870                                  Symbol rpiB Name (GenBank) Ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ccof  Campylobacter coli FB1 Pathway ccof00030   Pentose phosphate pathway ccof00051   Fructose and mannose metabolism ccof00710   Carbon fixation by Calvin cycle ccof01100   Metabolic pathways ccof01110   Biosynthesis of secondary metabolites ccof01120   Microbial metabolism in diverse environments ccof01200   Carbon metabolism ccof01230   Biosynthesis of amino acids Module ccof_M00007   Pentose phosphate pathway, non-oxidative phase, fructose-6P => ribose-5P Brite KEGG Orthology (KO) [BR:ccof00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     VC76_04660 (rpiB)    00051 Fructose and mannose metabolism     VC76_04660 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     VC76_04660 (rpiB) Enzymes [BR:ccof01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      VC76_04660 (rpiB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AJW58340 UniProt:  A0A0Q2KMN4 LinkDB All DBs Position 908336..908773 Genome browser AA seq 145 aa AA seqDB search MLRKKIYIASDHAGFMLKEKICTFLKEKQIPFDDLGTNDPTSCDYPDYAHLLASKIDEQS FGILICGSGIGISIAANRHKNIRCALCNESLSAKLARKHNDANVLAFGGRLIGIDAAIDM IENFIQTPFDQGRHVKRIQKIEVDC NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcttagaaaaaaaatttatattgctagcgatcatgcgggttttatgcttaaagaaaaa atttgtacctttcttaaagaaaagcaaattccttttgatgatcttgggacaaatgatcct actagttgtgattatccagattatgcacatttgttagcttctaaaatagatgaacaaagc tttggaattttaatttgtggttcagggataggaatttccatcgctgctaatcgtcataaa aacattcgctgtgccttatgtaatgaaagccttagtgctaaacttgctagaaaacacaat gatgcaaatgttttagcttttggaggtagattaataggcattgatgcagctatcgatatg atagaaaattttattcaaaccccttttgatcaaggtagacatgtaaaaagaattcaaaaa attgaggtagattgttaa

DBGET integrated database retrieval system